HPA020026

PDLIM5 antibody from Sigma-Aldrich
Enh, LIM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020026
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020026, RRID:AB_1855154
Product name
Anti-PDLIM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020026
Antibody type
Polyclonal
Antigen
PDZ and LIM domain protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTQSRSFRILAQITGTEHLKESEADNTKKANNSQE
PSPQLASSVASTRSMPESLDSPTSGRPGVTSLTTA
AAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSAT
YSGSVAPANSALGQTQPSDQDTLVQRAEHIPAGKR
TPMC
Storage
-20C
Provider Type Product Number
- No reagents -