PAB29398
antibody from Abnova Corporation
Targeting: RNF213
ALO17, C17orf27, KIAA1554, KIAA1618, MYMY2, NET57
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29398 - Provider product page

- Provider
- Abnova Corporation
- Product name
- RNF213 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human RNF213.
- Antigen sequence
VGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQE
ADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDL
HKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVL
VEGIVCISKKHLDKYIPYKYVIYNGESFEYEFIYK
H- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Human cell line RT-4 with RNF213 polyclonal antibody (Cat # PAB29398) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 with RNF213 polyclonal antibody (Cat # PAB29398) at 1-4 ug/mL concentration shows positivity in cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human rectum with RNF213 polyclonal antibody (Cat # PAB29398) shows moderate cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)