Antibody data

Product number
HPA046058
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA046058, RRID:AB_2679519
Product name
Anti-TM2D1
Provider product page
Atlas Antibodies - HPA046058
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSC
FPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVN
G
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.