Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [13]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042727 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042727, RRID:AB_10960691
- Product name
- Anti-SLC10A1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYK
GE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Host cell-dependent late entry step as determinant of hepatitis B virus infection
The kinesin KIF4 mediates HBV/HDV entry through the regulation of surface NTCP localization and can be targeted by RXR agonists in vitro
IFITM3 Interacts with the HBV/HDV Receptor NTCP and Modulates Virus Entry and Infection
Binding of Hepatitis B Virus Pre-S1 Domain-Derived Synthetic Myristoylated Peptide to Scavenger Receptor Class B Type 1 with Differential Properties from Sodium Taurocholate Cotransporting Polypeptide
Specific Binding and Endocytosis of Liposomes to HEK293T Cells via Myrisoylated Pre-S1 Peptide Bound to Sodium Taurocholate Cotransporting Polypeptide
Circadian control of hepatitis B virus replication
Severe Hepatotoxicity of Mithramycin Therapy Caused by Altered Expression of Hepatocellular Bile Transporters
Sideroflexin 3 is a Mitochondrial Protein Enriched in Neurons
Recapitulation of HDV infection in a fully permissive hepatoma cell line allows efficient drug evaluation
hNTCP‑expressing primary pig hepatocytes are a valuable tool for investigating hepatitis B virus infection and antiviral drugs
Human stem cell-derived hepatocyte-like cells support Zika virus replication and provide a relevant model to assess the efficacy of potential antivirals
Upregulation of sodium taurocholate cotransporter polypeptide during hepatogenic differentiation of umbilical cord matrix mesenchymal stem cells facilitates hepatitis B entry
Sodium taurocholate cotransporting polypeptide inhibition efficiently blocks hepatitis B virus spread in mice with a humanized liver
Siddiqui A, Hong X, Kawasawa Y, Menne S, Hu J
PLOS Pathogens 2022;18(6):e1010633
PLOS Pathogens 2022;18(6):e1010633
The kinesin KIF4 mediates HBV/HDV entry through the regulation of surface NTCP localization and can be targeted by RXR agonists in vitro
Hu J, Gad S, Sugiyama M, Tsuge M, Wakae K, Fukano K, Oshima M, Sureau C, Watanabe N, Kato T, Murayama A, Li Y, Shoji I, Shimotohno K, Chayama K, Muramatsu M, Wakita T, Nozaki T, Aly H
PLOS Pathogens 2022;18(3):e1009983
PLOS Pathogens 2022;18(3):e1009983
IFITM3 Interacts with the HBV/HDV Receptor NTCP and Modulates Virus Entry and Infection
Palatini M, Müller S, Kirstgen M, Leiting S, Lehmann F, Soppa L, Goldmann N, Müller C, Lowjaga K, Alber J, Ciarimboli G, Ziebuhr J, Glebe D, Geyer J
Viruses 2022;14(4):727
Viruses 2022;14(4):727
Binding of Hepatitis B Virus Pre-S1 Domain-Derived Synthetic Myristoylated Peptide to Scavenger Receptor Class B Type 1 with Differential Properties from Sodium Taurocholate Cotransporting Polypeptide
Hinuma S, Kuroda S
Viruses 2022;14(1):105
Viruses 2022;14(1):105
Specific Binding and Endocytosis of Liposomes to HEK293T Cells via Myrisoylated Pre-S1 Peptide Bound to Sodium Taurocholate Cotransporting Polypeptide
Hinuma S, Fujita K, Kuroda S
Vaccines 2022;10(12):2050
Vaccines 2022;10(12):2050
Circadian control of hepatitis B virus replication
Zhuang X, Forde D, Tsukuda S, D’Arienzo V, Mailly L, Harris J, Wing P, Borrmann H, Schilling M, Magri A, Rubio C, Maidstone R, Iqbal M, Garzon M, Minisini R, Pirisi M, Butterworth S, Balfe P, Ray D, Watashi K, Baumert T, McKeating J
Nature Communications 2021;12(1)
Nature Communications 2021;12(1)
Severe Hepatotoxicity of Mithramycin Therapy Caused by Altered Expression of Hepatocellular Bile Transporters
Sissung T, Huang P, Hauke R, McCrea E, Peer C, Barbier R, Strope J, Ley A, Zhang M, Hong J, Venzon D, Jackson J, Brouwer K, Grohar P, Glod J, Widemann B, Heller T, Schrump D, Figg W
Molecular Pharmacology 2019;96(2):158-167
Molecular Pharmacology 2019;96(2):158-167
Sideroflexin 3 is a Mitochondrial Protein Enriched in Neurons
Rivell A, Petralia R, Wang Y, Mattson M, Yao P
NeuroMolecular Medicine 2019;21(3):314-321
NeuroMolecular Medicine 2019;21(3):314-321
Recapitulation of HDV infection in a fully permissive hepatoma cell line allows efficient drug evaluation
Lempp F, Schlund F, Rieble L, Nussbaum L, Link C, Zhang Z, Ni Y, Urban S
Nature Communications 2019;10(1)
Nature Communications 2019;10(1)
hNTCP‑expressing primary pig hepatocytes are a valuable tool for investigating hepatitis B virus infection and antiviral drugs
Zhou M, Qin B, Deng X, Zeng X, Lu Y, Huang Z, Wu C, Mou L
Molecular Medicine Reports 2019
Molecular Medicine Reports 2019
Human stem cell-derived hepatocyte-like cells support Zika virus replication and provide a relevant model to assess the efficacy of potential antivirals
Li K, Tricot T, Helsen N, Kaptein S, Neyts J, Verfaillie C
PLOS ONE 2018;13(12):e0209097
PLOS ONE 2018;13(12):e0209097
Upregulation of sodium taurocholate cotransporter polypeptide during hepatogenic differentiation of umbilical cord matrix mesenchymal stem cells facilitates hepatitis B entry
Sargiacomo C, El-Kehdy H, Dallmeier K, de Kock J, Hernandez-Kelly C, Rogiers V, Ortega A, Neyts J, Sokal E, Najimi M
Stem Cell Research & Therapy 2017;8(1)
Stem Cell Research & Therapy 2017;8(1)
Sodium taurocholate cotransporting polypeptide inhibition efficiently blocks hepatitis B virus spread in mice with a humanized liver
Nakabori T, Hikita H, Murai K, Nozaki Y, Kai Y, Makino Y, Saito Y, Tanaka S, Wada H, Eguchi H, Takahashi T, Suemizu H, Sakamori R, Hiramatsu N, Tatsumi T, Takehara T
Scientific Reports 2016;6(1)
Scientific Reports 2016;6(1)
No comments: Submit comment
No validations: Submit validation data