PAB24124

AP5Z1 antibody from Abnova Corporation
KIAA0415, SPG48, zeta

Antibody data

Product number
PAB24124
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB24124, RRID:AB_11123206
Product name
AP5Z1 polyclonal antibody
Provider product page
Abnova Corporation - PAB24124
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant AP5Z1.
Antigen sequence
DDQWLNVQAFSMLRAWLLHSGPEGPGTLDTDDRSE
QEGSTLSVISATSSAGRLLPPRERLREVAFEYCQR
LIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQ
DPSFLYRSLS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -