PAB22897

TDRD6 antibody from Abnova Corporation
bA446F17.4, CT41.2, NY-CO-45, SPATA36
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
PAB22897
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22897, RRID:AB_10967255
Product name
TDRD6 polyclonal antibody
Provider product page
Abnova Corporation - PAB22897
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human TDRD6.
Reactivity
Human
Host
Rabbit
Antigen sequence
VSVVHTNKIGRLDLVNAILPGLCIHCSLQGFEVPD
NKNSKKMMHYFSQRTSEAAIRCEFVKFQDRWEVIL
ADEHGIIADDMISRY
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.