Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501738 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Structural Maintenance of Chromosomes 1A (SMC1A) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SMC1A antibody: synthetic peptide directed towards the C terminal of human SMC1A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDL
TKYPD ANPNPNEQ- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Chromatid cohesion defects may underlie chromosome instability in human colorectal cancers.
Barber TD, McManus K, Yuen KW, Reis M, Parmigiani G, Shen D, Barrett I, Nouhi Y, Spencer F, Markowitz S, Velculescu VE, Kinzler KW, Vogelstein B, Lengauer C, Hieter P
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 4;105(9):3443-8
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 4;105(9):3443-8
No comments: Submit comment
No validations: Submit validation data