HPA002947

POLA1 antibody from Atlas Antibodies
NSX, p180, POLA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002947
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002947, RRID:AB_1079652
Product name
Anti-POLA1
Provider product page
Atlas Antibodies - HPA002947
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYL
GSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLV
KGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWI
ESAETHVSCCVMVK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -