HPA002947

POLA1 antibody from Sigma-Aldrich
NSX, p180, POLA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002947
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002947, RRID:AB_1079652
Product name
Anti-POLA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002947
Antibody type
Polyclonal
Antigen
DNA polymerase alpha catalytic subunit recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYL
GSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLV
KGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWI
ESAETHVSCCVMVK
Storage
-20C
Provider Type Product Number
- No reagents -