HPA007990

GTF3A antibody from Sigma-Aldrich
AP2, TFIIIA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007990
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007990, RRID:AB_1857960
Product name
Anti-GTF3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007990
Antibody type
Polyclonal
Antigen
Transcription factor IIIA recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRKDYLKQHMKTHAPERDVCRCPREGCGRTYTTVF
NLQSHILSFHEESRPFVCEHAGCGKTFAMKQSLTR
HAVVHDPDKKKMKLKVKKSREKRSLASHLSGYIPP
KRKQGQGLSLCQNGESPNCVEDKMLSTV
Storage
-20C
Provider Type Product Number
- No reagents -