Antibody data

Product number
H00004952-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004952-M02, RRID:AB_581594
Product name
OCRL monoclonal antibody (M02), clone 4A6
Provider product page
Abnova Corporation - H00004952-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant OCRL.
Antigen sequence
SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPP
PFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQ
SGQREGLIKHILAKREKEYVNIQT
Isotype
IgG
Antibody clone number
4A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -