HPA012495

OCRL antibody from Sigma-Aldrich
OCRL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012495
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012495, RRID:AB_1851804
Product name
Anti-OCRL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012495
Antibody type
Polyclonal
Antigen
Inositol polyphosphate 5-phosphatase OCRL-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVT
KLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVP
KEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIID
CLDTSIPETIPGSNHSVAEALLIFLEALPEPVICY
ELY
Storage
-20C
Provider Type Product Number
- No reagents -