HPA012495

OCRL antibody from Atlas Antibodies
Dent-2, OCRL1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012495
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012495, RRID:AB_1851804
Product name
Anti-OCRL
Provider product page
Atlas Antibodies - HPA012495
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DYFLTISGNYLPSCFGTSLEALCRMKRPIREVPVT
KLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQVP
KEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIID
CLDTSIPETIPGSNHSVAEALLIFLEALPEPVICY
ELY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -