Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000087-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000087-M01, RRID:AB_509377
- Product name
- ACTN1 monoclonal antibody (M01), clone 3F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACTN1.
- Antigen sequence
EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSK
IVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVP
RRDQALTEEHARQQHNERLRKQFGAQA- Isotype
- IgG
- Antibody clone number
- 3F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Rab13 small G protein and junctional Rab13-binding protein (JRAB) orchestrate actin cytoskeletal organization during epithelial junctional development.
Alpha-actinin 1 and alpha-actinin 4: contrasting roles in the survival, motility, and RhoA signaling of astrocytoma cells.
Sakane A, Abdallah AA, Nakano K, Honda K, Ikeda W, Nishikawa Y, Matsumoto M, Matsushita N, Kitamura T, Sasaki T
The Journal of biological chemistry 2012 Dec 14;287(51):42455-68
The Journal of biological chemistry 2012 Dec 14;287(51):42455-68
Alpha-actinin 1 and alpha-actinin 4: contrasting roles in the survival, motility, and RhoA signaling of astrocytoma cells.
Quick Q, Skalli O
Experimental cell research 2010 Apr 15;316(7):1137-47
Experimental cell research 2010 Apr 15;316(7):1137-47
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ACTN1 expression in transfected 293T cell line by ACTN1 monoclonal antibody (M01), clone 3F1.Lane 1: ACTN1 transfected lysate(103.1 KDa).Lane 2: Non-transfected lysate.