Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000087-M01 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#H00000087-M01, RRID:AB_536564
- Product name
- Alpha Actinin 1 Antibody
- Antibody type
- Monoclonal
- Antigen
- ACTN1 (NP_001093, 543 a.a. ~ 640 a.a) partial recombinant protein with GST tag.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSK
IVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVP
RRDQALTEEHARQQHNERLRKQFGAQA- Isotype
- IgG
- Vial size
- 50 ug
- Storage
- Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Submitted references Rab13 small G protein and junctional Rab13-binding protein (JRAB) orchestrate actin cytoskeletal organization during epithelial junctional development.
Alpha-actinin 1 and alpha-actinin 4: contrasting roles in the survival, motility, and RhoA signaling of astrocytoma cells.
Sakane A, Abdallah AA, Nakano K, Honda K, Ikeda W, Nishikawa Y, Matsumoto M, Matsushita N, Kitamura T, Sasaki T
The Journal of biological chemistry 2012 Dec 14;287(51):42455-68
The Journal of biological chemistry 2012 Dec 14;287(51):42455-68
Alpha-actinin 1 and alpha-actinin 4: contrasting roles in the survival, motility, and RhoA signaling of astrocytoma cells.
Quick Q, Skalli O
Experimental cell research 2010 Apr 15;316(7):1137-47
Experimental cell research 2010 Apr 15;316(7):1137-47
No comments: Submit comment
No validations: Submit validation data