HPA003578

ARHGEF6 antibody from Atlas Antibodies
?Pix, alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003578
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003578, RRID:AB_1078203
Product name
Anti-ARHGEF6
Provider product page
Atlas Antibodies - HPA003578
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIY
QGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIV
VHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSS
SCSAHS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -