HPA003578

ARHGEF6 antibody from Sigma-Aldrich
alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003578
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003578, RRID:AB_1078203
Product name
Anti-ARHGEF6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003578
Antibody type
Polyclonal
Antigen
ρ-Guanine nucleotide exchange factor 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIY
QGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIV
VHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSS
SCSAHS
Storage
-20C
Provider Type Product Number
- No reagents -