HPA003355

SH3KBP1 antibody from Sigma-Aldrich
CIN85
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003355
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003355, RRID:AB_1079954
Product name
Anti-SH3KBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003355
Antibody type
Polyclonal
Antigen
SH3 domain-containing kinase-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WEGVLNGKTGMFPSNFIKELSGESDELGISQDEQL
SKSSLRETTGSESDGGDSSSTKSEGANGTVATAAI
QPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV
EKTIGKKLPATTATPDSSKTEMDSRTKSKDY
Storage
-20C
Provider Type Product Number
- No reagents -