HPA003133

HTR2C antibody from Sigma-Aldrich
5-HT2C, 5HTR2C, HTR1C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003133
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003133, RRID:AB_1079912
Product name
Anti-HTR2C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003133
Antibody type
Polyclonal
Antigen
5-Hydroxytryptamine 2C receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNT
AEEENSANPNQDQNARRRKKKERRPRGTMQAINNE
R
Storage
-20C
Provider Type Product Number
- No reagents -