HPA010090

GAB3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010090
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010090, RRID:AB_1849362
Product name
Anti-GAB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010090
Antibody type
Polyclonal
Antigen
GRB2-associated-binding protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CTLVPRRISLSGLDNMRTWKADVEGQSLRHRDKRL
SLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGL
GPHCSPDDYIPMNSGSISSPLPELPANLEPPPVNR
DLKPQRKSRPPPLDLRNLSIIREHASLTRTRTVPC
SRTSF
Storage
-20C
Provider Type Product Number
- No reagents -