HPA020352

METTL16 antibody from Atlas Antibodies
METT10D, MGC3329
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020352
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020352, RRID:AB_1853828
Product name
Anti-METTL16
Provider product page
Atlas Antibodies - HPA020352
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSP
VAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMH
WVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -