Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182466 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 81 (ZNF81) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF81 antibody: synthetic peptide directed towards the middle region of human ZNF81
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGD
KPYKC SDCGKGFTQK- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel X-linked member of the human zinc finger protein gene family: isolation, mapping, and expression.
Marino M, Archidiacono N, Franzé A, Rosati M, Rocchi M, Ballabio A, Grimaldi G
Mammalian genome : official journal of the International Mammalian Genome Society 1993;4(5):252-7
Mammalian genome : official journal of the International Mammalian Genome Society 1993;4(5):252-7
No comments: Submit comment
No validations: Submit validation data