ABIN182466

ZNF81 antibody from antibodies-online
HFZ20, MRX45
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN182466
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 81 (ZNF81) (Middle Region) antibody
Provider product page
antibodies-online - ABIN182466
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF81 antibody: synthetic peptide directed towards the middle region of human ZNF81
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGD
KPYKC SDCGKGFTQK
Epitope
Middle Region
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -