HPA024618

NEDD4L antibody from Atlas Antibodies
KIAA0439, NEDD4-2, RSP5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024618
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024618, RRID:AB_1854362
Product name
Anti-NEDD4L
Provider product page
Atlas Antibodies - HPA024618
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAK
DSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQS
FLPPGWEM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -