H00023327-A01

NEDD4L antibody from Abnova Corporation
KIAA0439, NEDD4-2, RSP5
No application information provided.

Antibody data

Product number
H00023327-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023327-A01, RRID:AB_1237905
Product name
NEDD4L polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00023327-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant NEDD4L.
Antigen sequence
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKK
DIFGASDPYVKLSLYVADENRELALVQTKTIKKTL
NPKWNEEFYFRVNPSNHRLLFEVFDENRLT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -