HPA024618

NEDD4L antibody from Sigma-Aldrich
KIAA0439, NEDD4-2, RSP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024618
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024618, RRID:AB_1854362
Product name
Anti-NEDD4L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024618
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase NEDD4-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAK
DSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQS
FLPPGWEM
Storage
-20C
Provider Type Product Number
- No reagents -