PAB30616
antibody from Abnova Corporation
		Targeting: ATP6AP2
		
		APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR	
	
	
	
	
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30616 - Provider product page 
- Provider
- Abnova Corporation
- Product name
- ATP6AP2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant human ATP6AP2.
- Antigen sequence
- NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAK
 DHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
 VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIR
 KTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with ATP6AP2 polyclonal antibody (Cat # PAB30616).
- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with ATP6AP2 polyclonal antibody (Cat # PAB30616).