HPA003156

ATP6AP2 antibody from Sigma-Aldrich
APT6M8-9, ATP6IP2, ATP6M8-9, M8-9, PRR, RENR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003156
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003156, RRID:AB_1078245
Product name
Anti-ATP6AP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003156
Antibody type
Polyclonal
Antigen
Renin receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAK
DHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKIL
VDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIR
KTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Storage
-20C
Provider Type Product Number
- No reagents -