SAB1401784

MAGEE1 antibody from Sigma-Aldrich
DAMAGE, KIAA1587
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1401784
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401784, RRID:AB_10608307
Product name
Anti-MAGEE1 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401784
Antibody type
Polyclonal
Antigen
MAGEE1 (AAH50588.1, 1 a.a. ~ 957 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MSLVSQNSRRRRRRVAKATAHNSSWGEMQAPNAPG
LPADVPGSDVPQGPSDSQILQGLCASEGPSTSVLP
TSAEGPSTFVPPTISEASSASGQPTISEGPGTSVL
PTPSEGLSTSGPPTISKGLCTSVTLAASEGRNTSR
PPTSSEEPSTSVPPTASEVPSTSLPPTPGEGTSTS
VPPTAYEGPSTSVVPTPDEGPSTSVLPTPGEGPGT
SVPLAATEGLSTSVQATPDEGPSTSVPPTATEGLS
TPVPPTRDEG
Storage
-20C
Provider Type Product Number
- No reagents -