HPA004932

INS antibody from Atlas Antibodies
IDDM1, IDDM2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004932
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004932, RRID:AB_1851816
Product name
Anti-INS
Provider product page
Atlas Antibodies - HPA004932
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVE
LGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSL
YQLENYC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -