Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004932 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004932, RRID:AB_1851816
- Product name
- Anti-INS
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVE
LGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSL
YQLENYC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Novel pancreatic beta cell-specific proteins: Antibody-based proteomics for identification of new biomarker candidates
Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets.
Lindskog C, Korsgren O, Pontén F, Eriksson J, Johansson L, Danielsson A
Journal of Proteomics 2012 May;75(9):2611-2620
Journal of Proteomics 2012 May;75(9):2611-2620
Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets.
Lindskog C, Asplund A, Engkvist M, Uhlen M, Korsgren O, Ponten F
Discovery medicine 2010 Jun;9(49):565-78
Discovery medicine 2010 Jun;9(49):565-78
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and INS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400078).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and INS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400078).
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human pancreas and liver tissues using Anti-INS antibody. Corresponding INS RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows cytoplasmic positivity in islets of Langerhans.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN