HPA003184

MED12 antibody from Atlas Antibodies
ARC240, CAGH45, FGS1, HOPA, KIAA0192, Kto, OKS, OPA1, TNRC11, TRAP230
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003184
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003184, RRID:AB_1079349
Product name
Anti-MED12
Provider product page
Atlas Antibodies - HPA003184
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTL
LEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKK
RSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNP
GSITHLNYRQGSIGLYTQNQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -