HPA003184

antibody from Atlas Antibodies

Targeting: MED12 ARC240, CAGH45, FGS1, HOPA, KIAA0192, Kto, OKS, OPA1, TNRC11, TRAP230

Antibody data

Submit

Validation data

Product number: HPA003184 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA003184, RRID:AB_1079349
Product name: Anti-MED12
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTL LEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKK RSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNP GSITHLNYRQGSIGLYTQNQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MED12 protein structure - HPA003184 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, spleen and testis using Anti-MED12 antibody HPA003184 (A) shows similar protein distribution across tissues to independent antibody HPA003185 (B).
Antibody #2 product nr: HPA003185
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MED12 antibody HPA003184.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MED12 antibody HPA003184.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MED12 antibody HPA003184.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen using Anti-MED12 antibody HPA003184.
Sample type: HUMAN