HPA003184

MED12 antibody from Sigma-Aldrich
CAGH45, FGS1, HOPA, KIAA0192, OKS, OPA1, TNRC11, TRAP230
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003184
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003184, RRID:AB_1079349
Product name
Anti-MED12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003184
Antibody type
Polyclonal
Antigen
Mediator of RNA polymerase II transcription subunit 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTL
LEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKK
RSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNP
GSITHLNYRQGSIGLYTQNQ
Storage
-20C
Provider Type Product Number
- No reagents -