HPA023072

IDO1 antibody from Atlas Antibodies

IDO, INDO

Validated within the Antibodypedia Validation Initative

Antibody data

Submit

Validation data

Product number: HPA023072
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA023072, RRID:AB_1846220
Product name: Anti-IDO1
Provider product page: Atlas Antibodies - HPA023072
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDF YNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHL TDHKSQRLARLVLGCITMAYVWGKGHGDVRKVL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Provider	Type	Product Number
- No reagents -

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows distinct cytoplasmic and nuclear positivity in cells outside the reaction centra.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in endothelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows strong positivity in non - germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate to strong positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and cerebral cortex tissues using HPA023072 antibody. Corresponding IDO1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.