Antibody data

Product number
H00003620-M43
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003620-M43, RRID:AB_1575615
Product name
IDO1 monoclonal antibody (M43), clone 3F3
Provider product page
Abnova Corporation - H00003620-M43
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant IDO1.
Antigen sequence
RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKA
LVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSK
LEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
Isotype
IgG
Antibody clone number
3F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -