HPA027772

IDO1 antibody from Sigma-Aldrich
IDO, INDO
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027772
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027772, RRID:AB_1846222
Product name
Anti-IDO1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027772
Antibody type
Polyclonal
Antigen
Indoleamine 2,3-dioxygenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNP
QLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVL
LGIQQTAGGGHAAQFLQDMRRYMPPAH
Storage
-20C
Provider Type Product Number
- No reagents -