HPA003164

FRMPD3 antibody from Sigma-Aldrich
KIAA1817, RP5-1070B1.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003164
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003164, RRID:AB_1078260
Product name
Anti-FRMPD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003164
Antibody type
Polyclonal
Antigen
FERM and PDZ domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVK
DVMLTLQDRLSLRFIEHFALVLEYAGPEQNHKFLL
LQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVEL
LRRDPAAFEYLYIQVESGL
Storage
-20C
Provider Type Product Number
- No reagents -