H00026025-B01P

PCDHGA12 antibody from Abnova Corporation
CDH21, FIB3, KIAA0588, PCDH-GAMMA-A12

Antibody data

Product number
H00026025-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026025-B01P, RRID:AB_1578476
Product name
PCDHGA12 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00026025-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PCDHGA12 protein.
Antigen sequence
MIPARLHRDYKGLVLLGILLGTLWETGCTQIRYSV
PEELEKGSRVGDISRDLGLEPRELAERGVRIIPRG
RTQLFALNPRSGSLVTAGRIDREELCMGAIKCQLN
LDILMEDKVKIYGVEVEVRDINDNAPYFRESELEI
KISENAATEMRFPLPHAWDPDIGKNSLQSYELSPN
THFSLIVQNGADGSKYPELVLKRALDREEKAAHHL
VLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQP
EYRASVPENLALGTQLLVVNATDPDEGVNAEVRYS
FRYVDDKAAQVFKLDCNSGTISTIGELDHEESGFY
QMEVQAMDNAGYSARAKVLITVLDVNDNAPEVVLT
SLASSVPENSPRGTLIALLNVNDQDSEENGQVICF
IQGNLPFKLEKSYGNYYSLVTDIVLDREQVPSYNI
TVTATDRGTPPLSTETHISLNVADTNDNPPVFPQA
SYSAYIPENNPRGVSLVSVTAHDPDCEENAQITYS
LAENTIQGASLSSYVSINSDTGVLYALSSFDYEQF
RDLQVKVMARDNGHPPLSSNVSLSLFVLDQNDNAP
EILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVD
RDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTAR
ALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVA
DSIPQVLADLGSLESPANSETSDLTLYLVVAVAAV
SCVFLAFVILLLALRLRRWHKSRLLQASGGGLTGA
PASHFVGVDGVQAFLQTYSHEVSLTTDSRKSHLIF
PQPNYADMLVSQESFEKSEPLLLSGDSVFSKDSHG
LIEQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGL
SARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGK
RDGKAPAGGNGNKKKSGKKEKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -