HPA023542

APBB2 antibody from Atlas Antibodies
FE65L, FE65L1, MGC35575
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA023542
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023542, RRID:AB_1844909
Product name
Anti-APBB2
Provider product page
Atlas Antibodies - HPA023542
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SEKLEGKEPHPQDSSSCEILPSQPRRTKSFLNYYA
DLETSARELEQNRGNHHGTAEEKSQPVQGQASTII
GNGDLLLQKPNRPQSSPEDGQVATVSSSPETKKDH
PKTGAKTDCALHRIQNLAPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -