HPA004128

PLP1 antibody from Sigma-Aldrich
GPM6C, PLP, SPG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004128
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004128, RRID:AB_1079635
Product name
Anti-PLP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004128
Antibody type
Polyclonal
Antigen
Myelin proteolipid protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTG
GQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVG
I
Storage
-20C
Provider Type Product Number
- No reagents -