HPA000271

antibody from Atlas Antibodies

Targeting: GAB2 KIAA0571

Antibody data

Submit

Validation data

Product number: HPA000271 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA000271, RRID:AB_1078925
Product name: Anti-GAB2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNH MQPTLSTSAPQEYLYLHQCISRRAENARSASFSQG TRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFY SLPKPSRHNTEFRDST
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GAB2 protein structure - HPA000271 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using HPA000271 antibody. Corresponding GAB2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Sample type: HUMAN