HPA000904

GMPR2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000904
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000904, RRID:AB_1078998
Product name
Anti-GMPR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000904
Antibody type
Polyclonal
Antigen
GMP reductase 2 (Guanosine 5'-monophosphate oxidoreductase 2) (Guanosine monophosphate reductase 2) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAK
AFGAGADFVMLGGMLAGHSESGGELIERDGKKYKL
FYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGD
VEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIR
VTQQV
Storage
-20C
Provider Type Product Number
- No reagents -