Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057761-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057761-M03, RRID:AB_464022
- Product name
- TRIB3 monoclonal antibody (M03), clone 1H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIB3.
- Antigen sequence
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPT
GTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTE
VLAGTQLLYAFFTRTHGDMH- Isotype
- IgG
- Antibody clone number
- 1H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody (M03), clone 1H2.Lane 1: TRIB3 transfected lysate(39.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TRIB3 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol