HPA015272

TRIB3 antibody from Sigma-Aldrich
C20orf97, dJ1103G7.3, TRB3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015272
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015272, RRID:AB_1858269
Product name
Anti-TRIB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015272
Antibody type
Polyclonal
Antigen
Tribbles homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGKIRRGAYALPAGLSAPARCLVRCLLRREPAERL
TATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDG
LGLDEAREEEGDREVVLYG
Storage
-20C
Provider Type Product Number
- No reagents -