Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015272 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TRIB3
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FGKIRRGAYALPAGLSAPARCLVRCLLRREPAERL
TATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDG
LGLDEAREEEGDREVVLYG- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Cellular stress induces TRB3/USP9x-dependent Notch activation in cancer
Abnormal expression of TRIB3 in colorectal cancer: a novel marker for prognosis
Izrailit J, Jaiswal A, Zheng W, Moran M, Reedijk M
Oncogene 2016;36(8):1048-1057
Oncogene 2016;36(8):1048-1057
Abnormal expression of TRIB3 in colorectal cancer: a novel marker for prognosis
Miyoshi N, Ishii H, Mimori K, Takatsuno Y, Kim H, Hirose H, Sekimoto M, Doki Y, Mori M
British Journal of Cancer 2009;101(10):1664-1670
British Journal of Cancer 2009;101(10):1664-1670
No comments: Submit comment
No validations: Submit validation data