R32074

MMP12 antibody from NSJ Bioreagents
HME
Western blot
Supportive data in Antibodypedia
ELISA
Recommended by provider

Antibody data

Product number
R32074
Provider
NSJ Bioreagents
Product name
Mmp12 Antibody
Provider product page
NSJ Bioreagents - R32074
Antibody type
Polyclonal
Antigen
Amino acids KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK of mouse Mmp-12 were used as the immunogen for the Mmp-12 antibody.
Description
Antigen affinity
Reactivity
Mouse
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the Mmp-12 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -