HPA002564

APEX1 antibody from Atlas Antibodies
APE, APE-1, APEN, APEX, APX, HAP1, REF-1, REF1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002564
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002564, RRID:AB_1078174
Product name
Anti-APEX1
Provider product page
Atlas Antibodies - HPA002564
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQ
CPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYV
PNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVL
CGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGE
LLQAVPLAD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -