HPA002564

APEX1 antibody from Sigma-Aldrich
APE, APE-1, APEN, APEX, APX, HAP1, REF-1, REF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002564
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002564, RRID:AB_1078174
Product name
Anti-APEX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002564
Antibody type
Polyclonal
Antigen
DNA-(apurinic or apyrimidinic site) lyase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQ
CPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYV
PNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVL
CGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGE
LLQAVPLAD
Storage
-20C
Provider Type Product Number
- No reagents -