HPA000261

TPM1 antibody from Atlas Antibodies
C15orf13, CMH3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000261
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000261, RRID:AB_1080339
Product name
Anti-TPM1
Provider product page
Atlas Antibodies - HPA000261
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKY
EEVARKLVIIESDLERAEERAELSEGQVRQLEEQL
RIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKL
KEAETRAEFAE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -