HPA000261

TPM1 antibody from Sigma-Aldrich
C15orf13, CMH3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000261
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000261, RRID:AB_1080339
Product name
Anti-TPM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000261
Antibody type
Polyclonal
Antigen
Tropomyosin-1 alpha-chain recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKY
EEVARKLVIIESDLERAEERAELSEGQVRQLEEQL
RIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKL
KEAETRAEFAE
Storage
-20C
Provider Type Product Number
- No reagents -