HPA002550

TTR antibody from Sigma-Aldrich
CTS, CTS1, HsT2651, PALB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002550
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002550, RRID:AB_1080419
Product name
Anti-TTR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002550
Antibody type
Polyclonal
Antigen
Transthyretin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAAD
DTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEI
DTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA
ALLSPYSYSTTAVVTNPKE
Storage
-20C
Provider Type Product Number
- No reagents -