Explore
Validate
LearnAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001524-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001524-M01, RRID:AB_464231
- Product name
- CX3CR1 monoclonal antibody (M01), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CX3CR1.
- Antigen sequence
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLS
I- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The involvement of the fractalkine receptor in the transmigration of neuroblastoma cells through bone-marrow endothelial cells.
Nevo I, Sagi-Assif O, Meshel T, Ben-Baruch A, Jöhrer K, Greil R, Trejo LE, Kharenko O, Feinmesser M, Yron I, Witz IP
Cancer letters 2009 Jan 8;273(1):127-39
Cancer letters 2009 Jan 8;273(1):127-39
No comments: Submit comment
No validations: Submit validation data